EVA results for 1i2v:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET
dssp	-EEEEE-------E---HHHHHHH------EE------EEEE--
apssp	---EE-EEE-EEE---------E------------E--------	-28.5	-37.5	-0.34
jpred	------EEEEEE--------------------EE------E---	-33.5	-41.4	-0.23
phd	-EEEEEEEEEEEEE------EEEEEE----EEE---EEEEE---	-15.0	-12.7	-0.14
phdpsi	--EEEEEEEEE-------HHHHHH-------EE-----EEEE--	+2.7	+7.2	+0.13
prof_king	---EEEEEEEEEE-------EEEEE---------EEEEEEEE--	-29.7	-34.5	-0.33
profsec	--EEEEEEEEEE-------HHHHH------EEE-----EEEEE-	-4.2	0.0	+0.03
psipred	---EEEEEEE-EE-------HHHH--------------------	-17.6	-32.8	-0.14
samt99_sec	---E-EEEEEEEE--------EEE---------------EEE--	-23.6	-36.5	-0.34
sspro2	--EEEEEEEEEEE--------EEE------------EE--E---	-29.9	-38.9	-0.39

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)