BLASTP 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1018085889-28439-18461 Query= Str_f1_(835. .1059)#75 aa#6-Apr-2002 (75 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 907,641 sequences; 284,333,007 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports Score E Sequences producing significant alignments: (bits) Value pir||I38945 melanoma ubiquitous mutated protein - human (fr... 31 3.1 gb|AAG13427.1|AC051634_8 (AC051634) hypothetical protein [O... 31 3.1 ref|NP_600418.1| (NC_003450) COG0671:Membrane-associated ph... 29 8.9 Alignments >pir||I38945 melanoma ubiquitous mutated protein - human (fragment) gb|AAC50240.1| (U20897) melanoma ubiquitous mutated protein [Homo sapiens] Length = 438 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 19 VQSQPWVVGSRPSPRTGAGSRYS-TFREVVRVGQHIPYAPAGDRRVPVCDGADRAGK 74 VQ +P G+ PSP G G R S T R R+G +A A R C + + K Sbjct: 341 VQLEPMAAGAAPSPGPGPGPRESVTPRSTARLGPPPSHASADATRCLPCPDSQKLEK 397 >gb|AAG13427.1|AC051634_8 (AC051634) hypothetical protein [Oryza sativa] Length = 439 Score = 30.8 bits (68), Expect = 3.1 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 8/64 (12%) Query: 2 RSSFVALYPLAGPATSPVQSQPWVVGSRPSPRTG-AGSRYSTFREVVRVGQH--IPYA-- 56 R+ F A+ G A + + S+PW+VGSR TG +G+ S+F + +GQ +P+A Sbjct: 44 RARFGAVCKGWGAAAARLPSRPWLVGSRADDWTGLSGATMSSF--WLSLGQRGLVPFAVD 101 Query: 57 -PAG 59 PAG Sbjct: 102 VPAG 105 >ref|NP_600418.1| (NC_003450) COG0671:Membrane-associated phospholipid phosphatase [Corynebacterium glutamicum] Length = 646 Score = 29.3 bits (64), Expect = 8.9 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Query: 15 ATSPVQSQPWVVGSRPSPRT---GAGSRYSTFREVVRVGQHIP-YAPAGDRRVPVCDGAD 70 AT Q + WV+ R T G G+ ++RE +VG IP PA V DG + Sbjct: 134 ATDAQQERAWVIDRRNQNYTATDGLGAYADSYRETAQVGTTIPDVVPADATTVKYNDGGN 193 Query: 71 RAG 73 G Sbjct: 194 VNG 196 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 29, 2002 2:16 AM Number of letters in database: 284,333,007 Number of sequences in database: 907,641 Lambda K H 0.318 0.136 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,925,740 Number of Sequences: 907641 Number of extensions: 1831768 Number of successful extensions: 4556 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 4556 Number of HSP's gapped (non-prelim): 3 length of query: 75 length of database: 284,333,007 effective HSP length: 51 effective length of query: 24 effective length of database: 238,043,316 effective search space: 5713039584 effective search space used: 5713039584 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)
RID: 1018085889-28439-18461
Query= Str_f1_(835. .1059)#75 aa#6-Apr-2002 (75 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 907,641 sequences; 284,333,007 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value pir||I38945 melanoma ubiquitous mutated protein - human (fr... 31 3.1 gb|AAG13427.1|AC051634_8 (AC051634) hypothetical protein [O... 31 3.1 ref|NP_600418.1| (NC_003450) COG0671:Membrane-associated ph... 29 8.9
>pir||I38945 melanoma ubiquitous mutated protein - human (fragment) gb|AAC50240.1| (U20897) melanoma ubiquitous mutated protein [Homo sapiens] Length = 438 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 19 VQSQPWVVGSRPSPRTGAGSRYS-TFREVVRVGQHIPYAPAGDRRVPVCDGADRAGK 74 VQ +P G+ PSP G G R S T R R+G +A A R C + + K Sbjct: 341 VQLEPMAAGAAPSPGPGPGPRESVTPRSTARLGPPPSHASADATRCLPCPDSQKLEK 397
>gb|AAG13427.1|AC051634_8 (AC051634) hypothetical protein [Oryza sativa] Length = 439 Score = 30.8 bits (68), Expect = 3.1 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 8/64 (12%) Query: 2 RSSFVALYPLAGPATSPVQSQPWVVGSRPSPRTG-AGSRYSTFREVVRVGQH--IPYA-- 56 R+ F A+ G A + + S+PW+VGSR TG +G+ S+F + +GQ +P+A Sbjct: 44 RARFGAVCKGWGAAAARLPSRPWLVGSRADDWTGLSGATMSSF--WLSLGQRGLVPFAVD 101 Query: 57 -PAG 59 PAG Sbjct: 102 VPAG 105
>ref|NP_600418.1| (NC_003450) COG0671:Membrane-associated phospholipid phosphatase [Corynebacterium glutamicum] Length = 646 Score = 29.3 bits (64), Expect = 8.9 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Query: 15 ATSPVQSQPWVVGSRPSPRT---GAGSRYSTFREVVRVGQHIP-YAPAGDRRVPVCDGAD 70 AT Q + WV+ R T G G+ ++RE +VG IP PA V DG + Sbjct: 134 ATDAQQERAWVIDRRNQNYTATDGLGAYADSYRETAQVGTTIPDVVPADATTVKYNDGGN 193 Query: 71 RAG 73 G Sbjct: 194 VNG 196
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 29, 2002 2:16 AM Number of letters in database: 284,333,007 Number of sequences in database: 907,641 Lambda K H 0.318 0.136 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,925,740 Number of Sequences: 907641 Number of extensions: 1831768 Number of successful extensions: 4556 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 4556 Number of HSP's gapped (non-prelim): 3 length of query: 75 length of database: 284,333,007 effective HSP length: 51 effective length of query: 24 effective length of database: 238,043,316 effective search space: 5713039584 effective search space used: 5713039584 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)
